PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N00100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 153aa    MW: 16968.7 Da    PI: 4.5668
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N00100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB154.61.8e-4819112497
             NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                       ++ +lPianv+rimk++lP+nakisk+aket+qecvsefi+fvtseas+kc++e+rkt+ng+d++ al tlGf+dy  +lk yl++yre+eg+
  Migut.N00100.1.p  19 DNMLLPIANVGRIMKQILPSNAKISKEAKETMQECVSEFIGFVTSEASEKCRNERRKTVNGEDICSALQTLGFDDYGGALKRYLSRYREIEGD 111
                       6789****************************************************************************************9 PP

             NF-YB  97 k 97 
                       +
  Migut.N00100.1.p 112 R 112
                       7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-4713129IPR009072Histone-fold
SuperFamilySSF471132.4E-3719140IPR009072Histone-fold
PfamPF008086.0E-272286IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.6E-155068No hitNo description
PRINTSPR006152.6E-156987No hitNo description
PRINTSPR006152.6E-1588106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MEDNINSEGA SSSSSTTTDN MLLPIANVGR IMKQILPSNA KISKEAKETM QECVSEFIGF  60
VTSEASEKCR NERRKTVNGE DICSALQTLG FDDYGGALKR YLSRYREIEG DRVVINQNKP  120
SGNNNNNNNI LQEDFLLYTS TNKTPNNDNL FD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4122107792Transcription factor HapC (Eurofung)
4g92_B2e-4122107792Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012842193.11e-108PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822482e-48NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9RT321e-57B9RT32_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPGSC0003DMT4000584145e-56(Solanum tuberosum)
STRINGPOPTR_0008s22520.11e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-49nuclear factor Y, subunit B5